PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010925709.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 314aa    MW: 36199.3 Da    PI: 7.5252
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010925709.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.33e-53101391128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhPtdeel+ +yL+kkv+ + ++l +vi++vd++k+ePwdL+ k ++ +  ++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk +
  XP_010925709.1  10 VPPGFRFHPTDEELLYYYLRKKVTYEAIDL-DVIRDVDLNKLEPWDLKdKcRIGSgPQNEWYFFSHKDKKYPTGTRTNRATTAGFWKATGRDKVI 103
                     69****************************.9***************943444443456************************************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     +  +++ +g++ktLvfy+grap+g+ktdW+mheyrl
  XP_010925709.1 104 HLGNSKRIGMRKTLVFYTGRAPHGQKTDWIMHEYRL 139
                     **********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.75E-597159IPR003441NAC domain
PROSITE profilePS5100558.07210159IPR003441NAC domain
PfamPF023652.8E-2811139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003002Biological Processregionalization
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0010455Biological Processpositive regulation of cell fate commitment
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MIPGNRQLTV PPGFRFHPTD EELLYYYLRK KVTYEAIDLD VIRDVDLNKL EPWDLKDKCR  60
IGSGPQNEWY FFSHKDKKYP TGTRTNRATT AGFWKATGRD KVIHLGNSKR IGMRKTLVFY  120
TGRAPHGQKT DWIMHEYRLD DESMEVQEDG WVVCRVFKKK NHQRCIPPES ILEDDQLDPL  180
RPNGFASMDQ KQNFQLPCDF SFDNNSMHLP QLLCSESTIP PLLPPASMNA FNLECSQNLM  240
KLTSTNGGGG LLPQEKFIGD WSILDKLLAS HQNLDQLIQS KYHPSSQLMD MGSSVQRFPF  300
QYLGCEADLL KFSK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-50716114167NO APICAL MERISTEM PROTEIN
1ut4_B1e-50716114167NO APICAL MERISTEM PROTEIN
1ut7_A1e-50716114167NO APICAL MERISTEM PROTEIN
1ut7_B1e-50716114167NO APICAL MERISTEM PROTEIN
3swm_A1e-50716117170NAC domain-containing protein 19
3swm_B1e-50716117170NAC domain-containing protein 19
3swm_C1e-50716117170NAC domain-containing protein 19
3swm_D1e-50716117170NAC domain-containing protein 19
3swp_A1e-50716117170NAC domain-containing protein 19
3swp_B1e-50716117170NAC domain-containing protein 19
3swp_C1e-50716117170NAC domain-containing protein 19
3swp_D1e-50716117170NAC domain-containing protein 19
4dul_A1e-50716114167NAC domain-containing protein 19
4dul_B1e-50716114167NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00250DAPTransfer from AT1G79580Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010925709.10.0PREDICTED: protein SOMBRERO-like
SwissprotQ9MA171e-115SMB_ARATH; Protein SOMBRERO
TrEMBLM0RI660.0M0RI66_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P14400_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34613781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79580.31e-107NAC family protein